Name : Recombinant Human IGF1, C-Fc

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P05019

Synonyms :
Recombinant Human IGF1, C-Fc

Amino Acid Sequence :

Molecular Weight :
39.4 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human IGF1 (Met1-Ala118) was fused with the C-terminal Fc Tag.

Formulation :
Supplied as solution form in PBS pH 7.4.

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
95233-18-4 custom synthesis 96829-58-2 References PMID:25905182 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Mouse Growth-regulated alpha protein(Cxcl1)

Brief Description :
Recombinant Protein

Accession No. :
P12850

Calculated MW :
7.8 kDa

Target Sequence :
APIANELRCQ CLQTMAGIHL KNIQSLKVLP SGPHCTQTEV IATLKNGREA CLDPEAPLVQ KIVQKMLKGV PK

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P12850

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TMEM192 Antibody web KIR3DL1 Antibody Technical Information PMID:34845824 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human ANXA5, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P08758

Synonyms :
Recombinant Human ANXA5, N-His

Amino Acid Sequence :

Molecular Weight :
38.25 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human ANXA5(Met1-Asp320) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1220411-29-9 MedChemExpress 163239-22-3 Molecular Weight PMID:29465926 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human NOX1, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
Q9Y5S8

Synonyms :
Recombinant Human NOX1, N-His

Amino Acid Sequence :

Molecular Weight :
28.62 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human NOX1(Arg54-Glu283) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
58-85-5 site 1353016-71-3 SMILES PMID:29489289 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human DISC1, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
Q9NRI5

Synonyms :
Recombinant Human DISC1, N-His

Amino Acid Sequence :

Molecular Weight :
18.68 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human DISC1(Ser102-Cys261) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
839712-12-8 Molecular Weight 2996998-09-3 manufacturer PMID:29369572 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Homo sapiens E3 ubiquitin-protein ligase TRIM21

Brief Description :
Recombinant Protein

Accession No. :
P19474

Calculated MW :
56.2 kDa

Target Sequence :
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P19474

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
MINPP1 Antibody Autophagy Sacubitril/Valsartan Purity & Documentation PMID:34974654 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human NOX5, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
Q96PH1

Synonyms :
Recombinant Human NOX5, N-His

Amino Acid Sequence :

Molecular Weight :
38.24 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human NOX5(Ser456-Phe765) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
56092-82-1 Description 127-31-1 References PMID:31082029 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Cavia porcellus Saposin-C

Brief Description :
Recombinant Protein

Accession No. :
P20097

Calculated MW :
10.9 kDa

Target Sequence :
ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P20097

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD325 Antibody Cancer Dnmt3a Antibody Protocol PMID:35228496 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human CENPI, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
Q92674

Synonyms :
Recombinant Human CENPI, N-His

Amino Acid Sequence :

Molecular Weight :
29.84 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human CENPI(Leu292-Gly528) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
58001-44-8 medchemexpress 39011-90-0 Biological Activity PMID:30000137 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Clathrin heavy chain 2

Brief Description :
Recombinant Protein

Accession No. :
P53675

Calculated MW :
18.8 kDa

Target Sequence :
LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P53675

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
UQCRC2 Antibody Epigenetics Cytokeratin 4 Antibody medchemexpress PMID:34962237 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com