Name :
OTOR (Human) Recombinant Protein
Biological Activity :
Human OTOR (Q9NRC9, 26 a.a. – 128 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q9NRC9
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56914
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSHMLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Molecular Weight :
14.3
Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Phosphate buffered saline (pH7.4), 30% glycerol and 1mM DTT.
Applications :
SDS-PAGE,
Gene Name :
OTOR
Gene Alias :
FDP, MGC126737, MGC126739, MIAL, MIAL1
Gene Description :
otoraplin
Gene Summary :
The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. [provided by RefSeq
Other Designations :
OTTHUMP00000030323|fibrocyte-derived protein|melanoma inhibitory activity-like protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGF-AA Proteinmanufacturer
MIP-1 alpha/CCL3 ProteinSynonyms
Popular categories:
Leukocyte Elastase Inhibitor
Ephrin-A5
