Name :
IFNA2 (Human) Recombinant Protein
Biological Activity :
Human IFNA2 (P01563, 24 a.a. – 188 a.a.) partial recombinant protein with His tag at C-terminus expressed in Nicotiana Sp.Plant.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P01563
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3440
Amino Acid Sequence :
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight :
19
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Plants
Interspecies Antigen Sequence :
Preparation Method :
Nicotiana Sp.Plant
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Functional Study, SDS-PAGE,
Gene Name :
IFNA2
Gene Alias :
IFNA, INFA2, MGC125764, MGC125765
Gene Description :
interferon, alpha 2
Gene Summary :
O
Other Designations :
OTTHUMP00000021143|alpha-2a interferon|interferon alpha 2b|interferon alpha A
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
M-CSF MedChemExpress
FSH Recombinant Proteins
Popular categories:
LILRA6
Cadherin-9
