Name :
SERPINF1 (Human) Recombinant Protein
Biological Activity :
Human SERPINF1 (P36955, 20 a.a. – 418 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag :
Protein Accession No. :
P36955
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=5176
Amino Acid Sequence :
QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Molecular Weight :
45
Storage and Stability :
Store at -20°C on dry atmosphere for 2 years.After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ion exchange column and HPLC reverse phase column
Quality Control Testing :
Storage Buffer :
Lyophilized from 20 mM PB, 150 mM NaCl, pH 7.5
Applications :
Functional Study， SDS-PAGE，
Gene Name :
SERPINF1
Gene Alias :
EPC-1, PEDF, PIG35
Gene Description :
serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
Gene Summary :
The PEDF gene is a member of the serpin gene family. Serpins are a group of serine protease inhibitors, some of which have also been reported to exhibit neurotrophic activity.[supplied by OMIM
Other Designations :
pigment epithelium-derived factor|proliferation-inducing protein 35|serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Carbonic Anhydrase 9 (CA IX) Recombinant Proteins
IL-5 ProteinSynonyms
Popular categories:
Cadherin-15
E2 Enzymes
